Top Purity Antimicrobial Peptide Ll- 37 Human CAS 154947-66-7

• Powder: Yes
• Customized: Customized
• Certification: GMP, HSE, ISO 9001, USP, BP
• Suitable for: Elderly, Children, Adult
• State: Powder
• Purity: >99%
• Model NO.: LM- LL- 37(Human)
• Product Name: Ll- 37(Human)
• CAS: 154947-66-7
• MOQ: 1kg
• Color: White
• Packaging Material: Aluminum Bags+Carton
• Test Method: HPLC
• Certificate: COA/MSDS
• Storage: Cool Dry Area
• Sample: Available
• Payment: Tt, Paypal, Western Union and So on
• Shipping: FedEx, UPS, Specially Line
• Transport Package: 1kg/Kg; 25kg/Drum
• Specification: 98%
• Trademark: Bpanda
• Origin: China
• Production Capacity: 500000kg / Month

Product Description

          

               Top Purity Antimicrobial Peptide LL- 37 Human CAS 154947-66-7
 

Product Description

 

Product Name:LL-37 Cas No:154947-66-7 MF:C205H340N60O53 EINECS:2381089-83-2 MW:4113.64 Quality:Refined Appearance: white powder Customized :Customized Type:Pharmaceutical Intermediates Shelf Life:2 Years When Properly Stored Storage: Keep in a cool, dry, dark location in a tightly sealed container or cylinder.

 

Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Specification

Chemistry
Sequence one letter code	[LL-37, 37 aa]
Sequence three letter code	H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS registry number	154947-66-7
Molecular Formula	C205H340N60O53
Molecular Mass/ Weight	4493.6

 

Our Advantages

1. Best quality with competitive price.
2. Quick shipping,delivery on time.
3. Alibaba Trade Assurances.
4. Support multiple trading methodsand payment.We support wire transfer, western union, Paypal or escrow (Alibaba) payment.
5. One to one business communication
6. OEM/ODM Avaliable.
7. We offer convenient one-station purchasing service.Our professionaland thoughtful after-sales service eliminates your worries.
8. We has manyyears' exporting experience in active pharmaceutical ingredient products.,Strictly on selecting raw materials.

Company Profile